PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN46161.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 387aa    MW: 44640.8 Da    PI: 8.6833
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN46161.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.3e-17102148148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W +eEd +l+ +vkq+G + W+ Ia+++  gR +kqc++rw+++l
       KHN46161.1 102 KGQWNQEEDRKLIMLVKQYGERKWAEIAEKLE-GRVGKQCRERWNNHL 148
                      799*****************************.*************97 PP

2Myb_DNA-binding44.82.8e-14154196145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W++eE+ +lvd +++ G++ W  Ia++++ gR+++ +k++w+
       KHN46161.1 154 KDSWSEEEERILVDTHARVGNR-WCEIAKRIQ-GRSENAIKNHWN 196
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.26897152IPR017930Myb domain
SuperFamilySSF466892.16E-26101195IPR009057Homeodomain-like
SMARTSM007177.8E-16101150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-27103156IPR009057Homeodomain-like
PfamPF139212.8E-18105162No hitNo description
CDDcd001679.84E-15105148No hitNo description
PROSITE profilePS5129417.511153203IPR017930Myb domain
SMARTSM007172.0E-13153201IPR001005SANT/Myb domain
CDDcd001673.62E-10156199No hitNo description
Gene3DG3DSA:1.10.10.604.3E-18157201IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MVRGESHGGD NGSQIYGYEA INASNPPLTA IDRFLCGHFS HQQQHARNND ASVFAAEEVF  60
NNKWTHINQT PTLCMKNMQV SGKNAKVVGR RSKKQSSVCW IKGQWNQEED RKLIMLVKQY  120
GERKWAEIAE KLEGRVGKQC RERWNNHLRP DIKKDSWSEE EERILVDTHA RVGNRWCEIA  180
KRIQGRSENA IKNHWNATKR RQNSKRKNKK TKSSINGKPH ILEDYIRSKT QIITNSNPTI  240
GSISTTDTTP HITLSQDSAA YPLNPVFYEP FANELLSMQQ IFTENVEASK HPKISPTSYL  300
DYCQMNVDDV GECEYSLQYP DNNNMHLNDT SLFPRETHPT PSNHLPSDLY YPSHLFNVVT  360
SNYGNQNLYN MDFRHQGCSD VKGERWI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C6e-411012023104C-Myb DNA-Binding Domain
1mse_C6e-411012023104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT0337661e-45CT033766.2 Medicago truncatula chromosome 5 clone mth4-42c9, COMPLETE SEQUENCE.
GenBankCT5735101e-45CT573510.2 Medicago truncatula chromosome 5 clone mth4-41f7, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006576074.10.0PREDICTED: transcription factor MYB48-like
TrEMBLA0A0B2SHF30.0A0A0B2SHF3_GLYSO; Transcription factor MYB98
TrEMBLI1JHB90.0I1JHB9_SOYBN; Uncharacterized protein
STRINGGLYMA02G39070.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.16e-64myb domain protein 119
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]